Lineage for d1ttua3 (1ttu A:381-541)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464258Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 464625Superfamily b.42.7: DNA-binding protein LAG-1 (CSL) [110217] (1 family) (S)
    contains rudiment hairpin triplet lacking one hairpin
  5. 464626Family b.42.7.1: DNA-binding protein LAG-1 (CSL) [110218] (1 protein)
  6. 464627Protein DNA-binding protein LAG-1 (CSL) [110219] (1 species)
  7. 464628Species Caenorhabditis elegans [110220] (1 PDB entry)
  8. 464629Domain d1ttua3: 1ttu A:381-541 [107307]
    Other proteins in same PDB: d1ttua1, d1ttua2

Details for d1ttua3

PDB Entry: 1ttu (more details), 2.85 Å

PDB Description: Crystal Structure of CSL bound to DNA

SCOP Domain Sequences for d1ttua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttua3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans}
ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfdderglqetd
nfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqm
idnelvylclshdkiiqhqatainehrhqindgaawtiist

SCOP Domain Coordinates for d1ttua3:

Click to download the PDB-style file with coordinates for d1ttua3.
(The format of our PDB-style files is described here.)

Timeline for d1ttua3: