Lineage for d1ttua3 (1ttu A:381-541)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792883Superfamily b.42.7: DNA-binding protein LAG-1 (CSL) [110217] (2 families) (S)
    contains rudiment hairpin triplet lacking one hairpin
    automatically mapped to Pfam PF09270
  5. 2792884Family b.42.7.1: DNA-binding protein LAG-1 (CSL) [110218] (1 protein)
  6. 2792885Protein DNA-binding protein LAG-1 (CSL) [110219] (1 species)
  7. 2792886Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110220] (4 PDB entries)
    Uniprot Q9TYY1 195-660
  8. 2792889Domain d1ttua3: 1ttu A:381-541 [107307]
    Other proteins in same PDB: d1ttua1, d1ttua2
    protein/DNA complex; complexed with edo

Details for d1ttua3

PDB Entry: 1ttu (more details), 2.85 Å

PDB Description: Crystal Structure of CSL bound to DNA
PDB Compounds: (A:) lin-12 And Glp-1 transcriptional regulator

SCOPe Domain Sequences for d1ttua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttua3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfdderglqetd
nfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqm
idnelvylclshdkiiqhqatainehrhqindgaawtiist

SCOPe Domain Coordinates for d1ttua3:

Click to download the PDB-style file with coordinates for d1ttua3.
(The format of our PDB-style files is described here.)

Timeline for d1ttua3: