Lineage for d1ttua1 (1ttu A:542-660)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770170Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 1770178Protein DNA-binding protein LAG-1 (CSL) [110052] (1 species)
  7. 1770179Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110053] (4 PDB entries)
    Uniprot Q9TYY1 195-660
  8. 1770182Domain d1ttua1: 1ttu A:542-660 [107305]
    Other proteins in same PDB: d1ttua2, d1ttua3
    protein/DNA complex; complexed with edo

Details for d1ttua1

PDB Entry: 1ttu (more details), 2.85 Å

PDB Description: Crystal Structure of CSL bound to DNA
PDB Compounds: (A:) lin-12 And Glp-1 transcriptional regulator

SCOPe Domain Sequences for d1ttua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttua1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvet
tfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyks

SCOPe Domain Coordinates for d1ttua1:

Click to download the PDB-style file with coordinates for d1ttua1.
(The format of our PDB-style files is described here.)

Timeline for d1ttua1: