Lineage for d1ttua1 (1ttu A:542-660)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456111Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (6 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 456112Protein DNA-binding protein LAG-1 (CSL) [110052] (1 species)
  7. 456113Species Caenorhabditis elegans [110053] (1 PDB entry)
  8. 456114Domain d1ttua1: 1ttu A:542-660 [107305]
    Other proteins in same PDB: d1ttua2, d1ttua3

Details for d1ttua1

PDB Entry: 1ttu (more details), 2.85 Å

PDB Description: Crystal Structure of CSL bound to DNA

SCOP Domain Sequences for d1ttua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttua1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans}
dkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvet
tfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyks

SCOP Domain Coordinates for d1ttua1:

Click to download the PDB-style file with coordinates for d1ttua1.
(The format of our PDB-style files is described here.)

Timeline for d1ttua1: