Lineage for d1tthd1 (1tth D:1-100)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193033Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 2193034Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 2193035Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 2193036Species Escherichia coli [TaxId:562] [54896] (60 PDB entries)
    Uniprot P00478
  8. 2193150Domain d1tthd1: 1tth D:1-100 [107301]
    Other proteins in same PDB: d1ttha2, d1ttha3, d1tthb2, d1tthc2, d1tthc3, d1tthd2
    complexed with pal, zn; mutant

Details for d1tthd1

PDB Entry: 1tth (more details), 2.8 Å

PDB Description: aspartate transcarbamoylase catalytic chain mutant glu50ala complexed with n-(phosphonacetyl-l-aspartate) (pala)
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1tthd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tthd1 d.58.2.1 (D:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d1tthd1:

Click to download the PDB-style file with coordinates for d1tthd1.
(The format of our PDB-style files is described here.)

Timeline for d1tthd1: