Lineage for d1tthd1 (1tth D:1-100)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603439Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 603440Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 603441Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 603444Species Escherichia coli [TaxId:562] [54896] (33 PDB entries)
  8. 603503Domain d1tthd1: 1tth D:1-100 [107301]
    Other proteins in same PDB: d1ttha2, d1ttha3, d1tthb2, d1tthc2, d1tthc3, d1tthd2
    complexed with pal, zn; mutant

Details for d1tthd1

PDB Entry: 1tth (more details), 2.8 Å

PDB Description: Aspartate Transcarbamoylase Catalytic Chain Mutant Glu50Ala Complexed with N-(Phosphonacetyl-L-Aspartate) (PALA)

SCOP Domain Sequences for d1tthd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tthd1 d.58.2.1 (D:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1tthd1:

Click to download the PDB-style file with coordinates for d1tthd1.
(The format of our PDB-style files is described here.)

Timeline for d1tthd1: