SCOP 1.71: Domain d1tthd1: 1tth D:1-100

Lineage for d1tthd1 (1tth D:1-100)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family)

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (2 species)

7. Species Escherichia coli [TaxId:562] [54896] (33 PDB entries)

8. Domain d1tthd1: 1tth D:1-100 [107301]
   Other proteins in same PDB: d1ttha2, d1ttha3, d1tthb2, d1tthc2, d1tthc3, d1tthd2
   complexed with pal, zn; mutant

Details for d1tthd1

PDB Entry: 1tth, 2.8 Å

PDB Description: aspartate transcarbamoylase catalytic chain mutant glu50ala complexed with n-(phosphonacetyl-l-aspartate) (pala)

SCOP Domain Sequences for d1tthd1:

Sequence; same for both SEQRES and ATOM records:

>d1tthd1 d.58.2.1 (D:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

Timeline for d1tthd1:

• d1tthd1 first appeared in SCOP 1.69
  
• d1tthd1 appears in SCOP 1.73
  
• d1tthd1 appears in the current release, SCOPe 2.08