Class g: Small proteins [56992] (94 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) automatically mapped to Pfam PF02748 |
Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein) |
Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species) |
Species Escherichia coli [TaxId:562] [57828] (60 PDB entries) Uniprot P00478 |
Domain d1tthb2: 1tth B:101-153 [107299] Other proteins in same PDB: d1ttha2, d1ttha3, d1tthb1, d1tthc2, d1tthc3, d1tthd1 complexed with pal, zn; mutant |
PDB Entry: 1tth (more details), 2.8 Å
SCOPe Domain Sequences for d1tthb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tthb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]} eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan
Timeline for d1tthb2: