Lineage for d1tthb1 (1tth B:1-100)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. Species Escherichia coli [TaxId:562] [54896] (62 PDB entries)
    Uniprot P00478
  8. Domain d1tthb1: 1tth B:1-100 [107298]
    Other proteins in same PDB: d1ttha2, d1ttha3, d1tthb2, d1tthc2, d1tthc3, d1tthd2
    complexed with pal, zn; mutant

Details for d1tthb1

PDB Entry: 1tth (more details), 2.8 Å

PDB Description: Aspartate Transcarbamoylase Catalytic Chain Mutant Glu50Ala Complexed with N-(Phosphonacetyl-L-Aspartate) (PALA)
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1tthb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tthb1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d1tthb1 are not available.

Timeline for d1tthb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tthb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ttha2, d1ttha3, d1tthc2, d1tthc3, d1tthd1, d1tthd2