Lineage for d1ttea2 (1tte A:2-160)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546043Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2546056Species Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId:4932] [69685] (3 PDB entries)
    Uniprot P21734
  8. 2546060Domain d1ttea2: 1tte A:2-160 [107296]
    Other proteins in same PDB: d1ttea1

Details for d1ttea2

PDB Entry: 1tte (more details)

PDB Description: the structure of a class ii ubiquitin-conjugating enzyme, ubc1.
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2-24 kda

SCOPe Domain Sequences for d1ttea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttea2 d.20.1.1 (A:2-160) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]}
srakrimkeiqavkddpaahitlefvsesdihhlkgtflgppgtpyeggkfvvdievpme
ypfkppkmqfdtkvyhpnissvtgaicldilrnawspvitlksalislqallqspepndp
qdaevaqhylrdresfnktaalwtrlyasetsngqkgnv

SCOPe Domain Coordinates for d1ttea2:

Click to download the PDB-style file with coordinates for d1ttea2.
(The format of our PDB-style files is described here.)

Timeline for d1ttea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ttea1