SCOP 1.71: Domain d1ttea2: 1tte A:2-160

Lineage for d1ttea2 (1tte A:2-160)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (3 families)

5. Family d.20.1.1: Ubiquitin conjugating enzyme, UBC [54496] (1 protein)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (18 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId:4932] [69685] (3 PDB entries)

8. Domain d1ttea2: 1tte A:2-160 [107296]
   Other proteins in same PDB: d1ttea1
   mutant

Details for d1ttea2

PDB Entry: 1tte

PDB Description: the structure of a class ii ubiquitin-conjugating enzyme, ubc1.

SCOP Domain Sequences for d1ttea2:

Sequence; same for both SEQRES and ATOM records:

>d1ttea2 d.20.1.1 (A:2-160) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1}
srakrimkeiqavkddpaahitlefvsesdihhlkgtflgppgtpyeggkfvvdievpme
ypfkppkmqfdtkvyhpnissvtgaicldilrnawspvitlksalislqallqspepndp
qdaevaqhylrdresfnktaalwtrlyasetsngqkgnv

Timeline for d1ttea2:

• d1ttea2 first appeared in SCOP 1.69
  
• d1ttea2 appears in SCOP 1.73
  
• d1ttea2 appears in the current release, SCOPe 2.08