SCOPe 2.07: Domain d1ttea1: 1tte A:161-215

Lineage for d1ttea1 (1tte A:161-215)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Ubiquitin-protein ligase ubc1 [109719] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109720] (1 PDB entry)
   Uniprot P21734

8. Domain d1ttea1: 1tte A:161-215 [107295]
   Other proteins in same PDB: d1ttea2

Details for d1ttea1

PDB Entry: 1tte

PDB Description: the structure of a class ii ubiquitin-conjugating enzyme, ubc1.

PDB Compounds: (A:) ubiquitin-conjugating enzyme e2-24 kda

SCOPe Domain Sequences for d1ttea1:

Sequence; same for both SEQRES and ATOM records:

>d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eesdlygidhdlidefesqgfekdkivevlrrlgvksldpndnntanriieellk

Timeline for d1ttea1:

• d1ttea1 first appeared in SCOP 1.69
  
• d1ttea1 appears in SCOPe 2.06
  
• d1ttea1 appears in the current release, SCOPe 2.08