Lineage for d1ttea1 (1tte A:161-215)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 907887Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 907911Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 907912Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 908015Protein Ubiquitin-protein ligase ubc1 [109719] (1 species)
  7. 908016Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109720] (1 PDB entry)
    Uniprot P21734
  8. 908017Domain d1ttea1: 1tte A:161-215 [107295]
    Other proteins in same PDB: d1ttea2

Details for d1ttea1

PDB Entry: 1tte (more details)

PDB Description: the structure of a class ii ubiquitin-conjugating enzyme, ubc1.
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2-24 kda

SCOPe Domain Sequences for d1ttea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eesdlygidhdlidefesqgfekdkivevlrrlgvksldpndnntanriieellk

SCOPe Domain Coordinates for d1ttea1:

Click to download the PDB-style file with coordinates for d1ttea1.
(The format of our PDB-style files is described here.)

Timeline for d1ttea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ttea2