Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins) automatically mapped to Pfam PF07876 |
Protein Boiling stable protein 1 [110953] (1 species) |
Species European aspen (Populus tremula) [TaxId:113636] [110954] (2 PDB entries) Uniprot Q9AR79 |
Domain d1tr0w_: 1tr0 W: [107282] complexed with gol |
PDB Entry: 1tr0 (more details), 1.8 Å
SCOPe Domain Sequences for d1tr0w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tr0w_ d.58.4.4 (W:) Boiling stable protein 1 {European aspen (Populus tremula) [TaxId: 113636]} trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
Timeline for d1tr0w_: