| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins) |
| Protein Boiling stable protein 1 [110953] (1 species) |
| Species European aspen (Populus tremula) [TaxId:113636] [110954] (2 PDB entries) |
| Domain d1tr0k_: 1tr0 K: [107271] |
PDB Entry: 1tr0 (more details), 1.8 Å
SCOP Domain Sequences for d1tr0k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tr0k_ d.58.4.4 (K:) Boiling stable protein 1 {European aspen (Populus tremula)}
trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
Timeline for d1tr0k_: