Lineage for d1tr0k_ (1tr0 K:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504226Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (11 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 504252Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)
  6. 504253Protein Boiling stable protein 1 [110953] (1 species)
  7. 504254Species European aspen (Populus tremula) [TaxId:113636] [110954] (2 PDB entries)
  8. 504265Domain d1tr0k_: 1tr0 K: [107271]

Details for d1tr0k_

PDB Entry: 1tr0 (more details), 1.8 Å

PDB Description: Crystal Structure of a boiling stable protein SP1

SCOP Domain Sequences for d1tr0k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tr0k_ d.58.4.4 (K:) Boiling stable protein 1 {European aspen (Populus tremula)}
trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly

SCOP Domain Coordinates for d1tr0k_:

Click to download the PDB-style file with coordinates for d1tr0k_.
(The format of our PDB-style files is described here.)

Timeline for d1tr0k_: