![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (49 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (11 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins) |
![]() | Protein Boiling stable protein 1 [110953] (1 species) |
![]() | Species European aspen (Populus tremula) [TaxId:113636] [110954] (2 PDB entries) |
![]() | Domain d1tr0h_: 1tr0 H: [107268] |
PDB Entry: 1tr0 (more details), 1.8 Å
SCOP Domain Sequences for d1tr0h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tr0h_ d.58.4.4 (H:) Boiling stable protein 1 {European aspen (Populus tremula)} trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
Timeline for d1tr0h_: