Lineage for d1tr0e_ (1tr0 E:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603552Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 603578Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)
  6. 603579Protein Boiling stable protein 1 [110953] (1 species)
  7. 603580Species European aspen (Populus tremula) [TaxId:113636] [110954] (2 PDB entries)
  8. 603585Domain d1tr0e_: 1tr0 E: [107265]

Details for d1tr0e_

PDB Entry: 1tr0 (more details), 1.8 Å

PDB Description: Crystal Structure of a boiling stable protein SP1

SCOP Domain Sequences for d1tr0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tr0e_ d.58.4.4 (E:) Boiling stable protein 1 {European aspen (Populus tremula)}
trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly

SCOP Domain Coordinates for d1tr0e_:

Click to download the PDB-style file with coordinates for d1tr0e_.
(The format of our PDB-style files is described here.)

Timeline for d1tr0e_: