Lineage for d1tqyh1 (1tqy H:2-246)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1626715Family c.95.1.1: Thiolase-related [53902] (9 proteins)
  6. 1626726Protein Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB [110754] (1 species)
  7. 1626727Species Streptomyces coelicolor [TaxId:1902] [110755] (1 PDB entry)
    Uniprot Q02062
  8. 1626734Domain d1tqyh1: 1tqy H:2-246 [107259]
    Other proteins in same PDB: d1tqya1, d1tqya2, d1tqyc1, d1tqyc2, d1tqye1, d1tqye2, d1tqyg1, d1tqyg2
    complexed with ace, mg, na

Details for d1tqyh1

PDB Entry: 1tqy (more details), 2 Å

PDB Description: the actinorhodin ketosynthase/chain length factor
PDB Compounds: (H:) Actinorhodin polyketide putative beta-ketoacyl synthase 2

SCOPe Domain Sequences for d1tqyh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqyh1 c.95.1.1 (H:2-246) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]}
svlitgvgvvapnglglapywsavldgrhglgpvtrfdvsrypatlagqiddfhapdhip
grllpqtdpstrlaltaadwalqdakadpesltdydmgvvtanacggfdfthrefrklws
egpksvsvyesfawfyavntgqisirhgmrgpssalvaeqaggldalgharrtirrgtpl
vvsggvdsaldpwgwvsqiasgristatdpdraylpfderaagyvpgeggailvledsaa
aearg

SCOPe Domain Coordinates for d1tqyh1:

Click to download the PDB-style file with coordinates for d1tqyh1.
(The format of our PDB-style files is described here.)

Timeline for d1tqyh1: