![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (2 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (7 proteins) |
![]() | Protein Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB [110754] (1 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [110755] (1 PDB entry) |
![]() | Domain d1tqyf1: 1tqy F:2-209 [107255] Other proteins in same PDB: d1tqya1, d1tqya2, d1tqyc1, d1tqyc2, d1tqye1, d1tqye2, d1tqyg1, d1tqyg2 |
PDB Entry: 1tqy (more details), 2 Å
SCOP Domain Sequences for d1tqyf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqyf1 c.95.1.1 (F:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor} svlitgvgvvapnglglapywsavldgrhglgpvtrfdvsrypatlagqiddfhapdhip grllpqtdpstrlaltaadwalqdakadpesltdydmgvvtanacggfdfthrefrklws egpksvsvyesfawfyavntgqisirhgmrgpssalvaeqaggldalgharrtirrgtpl vvsggvdsaldpwgwvsqiasgristat
Timeline for d1tqyf1: