Lineage for d1tqyc1 (1tqy C:3-218)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 593921Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 593922Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 593923Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 593924Protein Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA [110752] (1 species)
  7. 593925Species Streptomyces coelicolor [TaxId:1902] [110753] (1 PDB entry)
  8. 593928Domain d1tqyc1: 1tqy C:3-218 [107249]
    Other proteins in same PDB: d1tqyb1, d1tqyb2, d1tqyd1, d1tqyd2, d1tqyf1, d1tqyf2, d1tqyh1, d1tqyh2

Details for d1tqyc1

PDB Entry: 1tqy (more details), 2 Å

PDB Description: the actinorhodin ketosynthase/chain length factor

SCOP Domain Sequences for d1tqyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqyc1 c.95.1.1 (C:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor}
rrvvitgvgvrapggngtrqfwelltsgrtatrrisffdpspyrsqvaaeadfdpvaegf
gpreldrmdrasqfavacareafaasgldpdtldparvgvslgsavaaatslereyllls
dsgrdwevdaawlsrhmfdylvpsvmpaevawavgaegpvtmvstgctsgldsvgnavra
ieegsadvmfagaadtpitpivvacfdairattarn

SCOP Domain Coordinates for d1tqyc1:

Click to download the PDB-style file with coordinates for d1tqyc1.
(The format of our PDB-style files is described here.)

Timeline for d1tqyc1: