Lineage for d1tqyb1 (1tqy B:2-209)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846958Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 846959Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 846960Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 846971Protein Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB [110754] (1 species)
  7. 846972Species Streptomyces coelicolor [TaxId:1902] [110755] (1 PDB entry)
    Uniprot Q02062
  8. 846973Domain d1tqyb1: 1tqy B:2-209 [107247]
    Other proteins in same PDB: d1tqya1, d1tqya2, d1tqyc1, d1tqyc2, d1tqye1, d1tqye2, d1tqyg1, d1tqyg2

Details for d1tqyb1

PDB Entry: 1tqy (more details), 2 Å

PDB Description: the actinorhodin ketosynthase/chain length factor
PDB Compounds: (B:) Actinorhodin polyketide putative beta-ketoacyl synthase 2

SCOP Domain Sequences for d1tqyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]}
svlitgvgvvapnglglapywsavldgrhglgpvtrfdvsrypatlagqiddfhapdhip
grllpqtdpstrlaltaadwalqdakadpesltdydmgvvtanacggfdfthrefrklws
egpksvsvyesfawfyavntgqisirhgmrgpssalvaeqaggldalgharrtirrgtpl
vvsggvdsaldpwgwvsqiasgristat

SCOP Domain Coordinates for d1tqyb1:

Click to download the PDB-style file with coordinates for d1tqyb1.
(The format of our PDB-style files is described here.)

Timeline for d1tqyb1: