![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (2 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (7 proteins) |
![]() | Protein Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA [110752] (1 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [110753] (1 PDB entry) |
![]() | Domain d1tqya2: 1tqy A:219-423 [107246] Other proteins in same PDB: d1tqyb1, d1tqyb2, d1tqyd1, d1tqyd2, d1tqyf1, d1tqyf2, d1tqyh1, d1tqyh2 |
PDB Entry: 1tqy (more details), 2 Å
SCOP Domain Sequences for d1tqya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor} ddpehasrpfdgtrdgfvlaegaamfvledydsalargarihaeisgyatrcnayhmtgl kadgremaetirvaldesrtdatdidyinahgsgtrqndrhetaaykralgeharrtpvs siksmvghslgaigsleiaacvlalehgvvpptanlrtsdpecdldyvplearerklrsv ltvgsgfggfqsamvlrdaetagaa
Timeline for d1tqya2: