Lineage for d1tqqb_ (1tqq B:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519379Fold f.5: Integral outer membrane protein TolC, efflux pump component [56953] (1 superfamily)
    subunit fold contains tandem repeat of alpha-beta hairpin-alpha(2) motif
    trimeric fold contains barrel (n=12, S=18) formed by beta-hairpins, two from each subunit, and a bundle of helices with a channel running through it
  4. 519380Superfamily f.5.1: Integral outer membrane protein TolC, efflux pump component [56954] (1 family) (S)
  5. 519381Family f.5.1.1: Integral outer membrane protein TolC, efflux pump component [56955] (1 protein)
  6. 519382Protein Integral outer membrane protein TolC, efflux pump component [56956] (1 species)
  7. 519383Species Escherichia coli [TaxId:562] [56957] (2 PDB entries)
  8. 519388Domain d1tqqb_: 1tqq B: [107243]

Details for d1tqqb_

PDB Entry: 1tqq (more details), 2.75 Å

PDB Description: Structure of TolC in complex with hexamminecobalt

SCOP Domain Sequences for d1tqqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqqb_ f.5.1.1 (B:) Integral outer membrane protein TolC, efflux pump component {Escherichia coli}
enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
nsnatsaslqltqsifdmskwraltlqekaagiqdvtyqtdqqtlilntatayfnvlnai
dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlaneltarnnldnave
qlrqitgnyypelaalnvenfktdkpqpvnallkeaekrnlsllqarlsqdlareqirqa
qdghlptldltastgisdtsysgsktrgaagtqyddsnmgqnkvglsfslpiyqggmvns
qvkqaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldamea
gysvgtrtivdvldatttlynakqelanarynylinqlniksalgtlneqdllalnnals
kpvstnpe

SCOP Domain Coordinates for d1tqqb_:

Click to download the PDB-style file with coordinates for d1tqqb_.
(The format of our PDB-style files is described here.)

Timeline for d1tqqb_: