Lineage for d1tqpa1 (1tqp A:1-90)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983430Family a.4.5.56: Rio2 serine protein kinase N-terminal domain [109702] (1 protein)
    automatically mapped to Pfam PF09202
  6. 1983431Protein Rio2 serine protein kinase N-terminal domain [109703] (1 species)
  7. 1983432Species Archaeoglobus fulgidus [TaxId:2234] [109704] (5 PDB entries)
    Uniprot O30245 # AF2426
  8. 1983437Domain d1tqpa1: 1tqp A:1-90 [107240]
    Other proteins in same PDB: d1tqpa2
    complexed with atp

Details for d1tqpa1

PDB Entry: 1tqp (more details), 2.1 Å

PDB Description: Crystal Structure of A. fulgidus Rio2 Serine Protein Kinase Bound to ATP
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1tqpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqpa1 a.4.5.56 (A:1-90) Rio2 serine protein kinase N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
mniaelygkmgkhswrimdaifknlwdyeyvplqlissharigeekarnilkylsdlrvv
qnrqkdyegstftfiglslyslhrlvrsgk

SCOPe Domain Coordinates for d1tqpa1:

Click to download the PDB-style file with coordinates for d1tqpa1.
(The format of our PDB-style files is described here.)

Timeline for d1tqpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tqpa2