![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.56: Rio2 serine protein kinase N-terminal domain [109702] (1 protein) automatically mapped to Pfam PF09202 |
![]() | Protein Rio2 serine protein kinase N-terminal domain [109703] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [109704] (5 PDB entries) Uniprot O30245 # AF2426 |
![]() | Domain d1tqpa1: 1tqp A:1-90 [107240] Other proteins in same PDB: d1tqpa2 complexed with atp |
PDB Entry: 1tqp (more details), 2.1 Å
SCOPe Domain Sequences for d1tqpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqpa1 a.4.5.56 (A:1-90) Rio2 serine protein kinase N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} mniaelygkmgkhswrimdaifknlwdyeyvplqlissharigeekarnilkylsdlrvv qnrqkdyegstftfiglslyslhrlvrsgk
Timeline for d1tqpa1: