Lineage for d1tqma1 (1tqm A:1-90)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 439174Family a.4.5.56: Rio2 serine protein kinase N-terminal domain [109702] (1 protein)
  6. 439175Protein Rio2 serine protein kinase N-terminal domain [109703] (1 species)
  7. 439176Species Archaeoglobus fulgidus [TaxId:2234] [109704] (3 PDB entries)
  8. 439178Domain d1tqma1: 1tqm A:1-90 [107236]
    Other proteins in same PDB: d1tqma2

Details for d1tqma1

PDB Entry: 1tqm (more details), 1.99 Å

PDB Description: Crystal Structure of A. fulgidus Rio2 Serine Protein Kinase Bound to AMPPNP

SCOP Domain Sequences for d1tqma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqma1 a.4.5.56 (A:1-90) Rio2 serine protein kinase N-terminal domain {Archaeoglobus fulgidus}
mniaelygkmgkhswrimdaifknlwdyeyvplqlissharigeekarnilkylsdlrvv
qnrqkdyegstftfiglslyslhrlvrsgk

SCOP Domain Coordinates for d1tqma1:

Click to download the PDB-style file with coordinates for d1tqma1.
(The format of our PDB-style files is described here.)

Timeline for d1tqma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tqma2