Lineage for d1tqjf_ (1tqj F:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570417Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (5 families) (S)
  5. 570444Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)
  6. 570445Protein D-ribulose-5-phosphate 3-epimerase [51373] (4 species)
  7. 570458Species Synechocystis sp. strain PCC 6803 [TaxId:1148] [110343] (1 PDB entry)
  8. 570464Domain d1tqjf_: 1tqj F: [107233]

Details for d1tqjf_

PDB Entry: 1tqj (more details), 1.6 Å

PDB Description: Crystal structure of D-ribulose 5-phosphate 3-epimerase from Synechocystis to 1.6 angstrom resolution

SCOP Domain Sequences for d1tqjf_:

Sequence, based on SEQRES records: (download)

>d1tqjf_ c.1.2.2 (F:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. strain PCC 6803}
knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
tpldfleyvlpvcdlilimsvnpgfggqsfipevlpkiralrqmcdergldpwievdggl
kpnntwqvleaganaivagsavfnapnyaeaiagvrnskrp

Sequence, based on observed residues (ATOM records): (download)

>d1tqjf_ c.1.2.2 (F:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. strain PCC 6803}
knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
tpldfleyvlpvcdlilimsvnpqsfipevlpkiralrqmcdergldpwievdgglkpnn
twqvleaganaivagsavfnapnyaeaiagvrnskrp

SCOP Domain Coordinates for d1tqjf_:

Click to download the PDB-style file with coordinates for d1tqjf_.
(The format of our PDB-style files is described here.)

Timeline for d1tqjf_: