SCOP 1.69: Domain d1tqjf_: 1tqj F:

Lineage for d1tqjf_ (1tqj F:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families)

5. Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)

6. Protein D-ribulose-5-phosphate 3-epimerase [51373] (3 species)

7. Species Synechocystis sp. strain PCC 6803 [TaxId:1148] [110343] (1 PDB entry)

8. Domain d1tqjf_: 1tqj F: [107233]

Details for d1tqjf_

PDB Entry: 1tqj, 1.6 Å

PDB Description: Crystal structure of D-ribulose 5-phosphate 3-epimerase from Synechocystis to 1.6 angstrom resolution

SCOP Domain Sequences for d1tqjf_:

Sequence, based on SEQRES records:

>d1tqjf_ c.1.2.2 (F:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. strain PCC 6803}
knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
tpldfleyvlpvcdlilimsvnpgfggqsfipevlpkiralrqmcdergldpwievdggl
kpnntwqvleaganaivagsavfnapnyaeaiagvrnskrp

Sequence, based on observed residues (ATOM records):

>d1tqjf_ c.1.2.2 (F:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. strain PCC 6803}
knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
tpldfleyvlpvcdlilimsvnpqsfipevlpkiralrqmcdergldpwievdgglkpnn
twqvleaganaivagsavfnapnyaeaiagvrnskrp

Timeline for d1tqjf_:

• d1tqjf_ is new in SCOP 1.69
  
• d1tqjf_ appears in SCOP 1.71
  
• d1tqjf_ appears in the current release, SCOPe 2.08