Lineage for d1tqjd_ (1tqj D:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814383Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 814414Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)
  6. 814415Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species)
  7. 814441Species Synechocystis sp. PCC 6803 [TaxId:1148] [110343] (1 PDB entry)
    Uniprot P74061
  8. 814445Domain d1tqjd_: 1tqj D: [107231]

Details for d1tqjd_

PDB Entry: 1tqj (more details), 1.6 Å

PDB Description: Crystal structure of D-ribulose 5-phosphate 3-epimerase from Synechocystis to 1.6 angstrom resolution
PDB Compounds: (D:) ribulose-phosphate 3-epimerase

SCOP Domain Sequences for d1tqjd_:

Sequence, based on SEQRES records: (download)

>d1tqjd_ c.1.2.2 (D:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]}
knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
tpldfleyvlpvcdlilimsvnpgfggqsfipevlpkiralrqmcdergldpwievdggl
kpnntwqvleaganaivagsavfnapnyaeaiagvrnskrp

Sequence, based on observed residues (ATOM records): (download)

>d1tqjd_ c.1.2.2 (D:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]}
knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
tpldfleyvlpvcdlilimsvnqsfipevlpkiralrqmcdergldpwievdgglkpnnt
wqvleaganaivagsavfnapnyaeaiagvrnskrp

SCOP Domain Coordinates for d1tqjd_:

Click to download the PDB-style file with coordinates for d1tqjd_.
(The format of our PDB-style files is described here.)

Timeline for d1tqjd_: