Lineage for d1tqjb_ (1tqj B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473421Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 473448Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)
  6. 473449Protein D-ribulose-5-phosphate 3-epimerase [51373] (3 species)
  7. 473459Species Synechocystis sp. strain PCC 6803 [TaxId:1148] [110343] (1 PDB entry)
  8. 473461Domain d1tqjb_: 1tqj B: [107229]

Details for d1tqjb_

PDB Entry: 1tqj (more details), 1.6 Å

PDB Description: Crystal structure of D-ribulose 5-phosphate 3-epimerase from Synechocystis to 1.6 angstrom resolution

SCOP Domain Sequences for d1tqjb_:

Sequence, based on SEQRES records: (download)

>d1tqjb_ c.1.2.2 (B:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. strain PCC 6803}
knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
tpldfleyvlpvcdlilimsvnpgfggqsfipevlpkiralrqmcdergldpwievdggl
kpnntwqvleaganaivagsavfnapnyaeaiagvrnskrpe

Sequence, based on observed residues (ATOM records): (download)

>d1tqjb_ c.1.2.2 (B:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. strain PCC 6803}
knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
ktldvhlmivepekyvedfakagadiisvhvehnahlhrtlcqirelgkkagavlnpstp
ldfleyvlpvcdlilimsvnsfipevlpkiralrqmcdergldpwievdgglkpnntwqv
leaganaivagsavfnapnyaeaiagvrnskrpe

SCOP Domain Coordinates for d1tqjb_:

Click to download the PDB-style file with coordinates for d1tqjb_.
(The format of our PDB-style files is described here.)

Timeline for d1tqjb_: