Lineage for d1tqjb_ (1tqj B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079125Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)
    automatically mapped to Pfam PF00834
  6. 2079126Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species)
  7. 2079141Species Synechocystis sp. PCC 6803 [TaxId:1148] [110343] (1 PDB entry)
    Uniprot P74061
  8. 2079143Domain d1tqjb_: 1tqj B: [107229]

Details for d1tqjb_

PDB Entry: 1tqj (more details), 1.6 Å

PDB Description: Crystal structure of D-ribulose 5-phosphate 3-epimerase from Synechocystis to 1.6 angstrom resolution
PDB Compounds: (B:) ribulose-phosphate 3-epimerase

SCOPe Domain Sequences for d1tqjb_:

Sequence, based on SEQRES records: (download)

>d1tqjb_ c.1.2.2 (B:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]}
knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
tpldfleyvlpvcdlilimsvnpgfggqsfipevlpkiralrqmcdergldpwievdggl
kpnntwqvleaganaivagsavfnapnyaeaiagvrnskrpe

Sequence, based on observed residues (ATOM records): (download)

>d1tqjb_ c.1.2.2 (B:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]}
knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
ktldvhlmivepekyvedfakagadiisvhvehnahlhrtlcqirelgkkagavlnpstp
ldfleyvlpvcdlilimsvnsfipevlpkiralrqmcdergldpwievdgglkpnntwqv
leaganaivagsavfnapnyaeaiagvrnskrpe

SCOPe Domain Coordinates for d1tqjb_:

Click to download the PDB-style file with coordinates for d1tqjb_.
(The format of our PDB-style files is described here.)

Timeline for d1tqjb_: