SCOPe 2.05: Domain d1tqha_: 1tqh A:

Lineage for d1tqha_ (1tqh A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.29: Carboxylesterase/lipase [102623] (1 protein)
   automatically mapped to Pfam PF12697

6. Protein Carboxylesterase Est [102624] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [102625] (2 PDB entries)
   Uniprot Q06174

8. Domain d1tqha_: 1tqh A: [107225]
   complexed with 4pa, so4

Details for d1tqha_

PDB Entry: 1tqh, 1.63 Å

PDB Description: covalent reaction intermediate revealed in crystal structure of the geobacillus stearothermophilus carboxylesterase est30

PDB Compounds: (A:) Carboxylesterase precursor

SCOPe Domain Sequences for d1tqha_:

Sequence; same for both SEQRES and ATOM records:

>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}
ppkpfffeageravlllhgftgnsadvrmlgrfleskgytchapiykghgvppeelvhtg
pddwwqdvmngyeflknkgyekiavaglslggvfslklgytvpiegivtmcapmyiksee
tmyegvleyareykkregkseeqieqemekfkqtpmktlkalqeliadvrdhldliyapt
fvvqarhdeminpdsaniiyneiespvkqikwyeqsghvitldqekdqlhediyaflesl
dw

Timeline for d1tqha_:

• d1tqha_ first appeared in SCOP 1.69
  
• d1tqha_ appears in SCOPe 2.04
  
• d1tqha_ appears in SCOPe 2.06
  
• d1tqha_ appears in the current release, SCOPe 2.08