Lineage for d1tqha_ (1tqh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901659Family c.69.1.29: Carboxylesterase/lipase [102623] (1 protein)
    automatically mapped to Pfam PF12697
  6. 2901660Protein Carboxylesterase Est [102624] (1 species)
  7. 2901661Species Bacillus stearothermophilus [TaxId:1422] [102625] (2 PDB entries)
    Uniprot Q06174
  8. 2901662Domain d1tqha_: 1tqh A: [107225]
    complexed with 4pa, so4

Details for d1tqha_

PDB Entry: 1tqh (more details), 1.63 Å

PDB Description: covalent reaction intermediate revealed in crystal structure of the geobacillus stearothermophilus carboxylesterase est30
PDB Compounds: (A:) Carboxylesterase precursor

SCOPe Domain Sequences for d1tqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}
ppkpfffeageravlllhgftgnsadvrmlgrfleskgytchapiykghgvppeelvhtg
pddwwqdvmngyeflknkgyekiavaglslggvfslklgytvpiegivtmcapmyiksee
tmyegvleyareykkregkseeqieqemekfkqtpmktlkalqeliadvrdhldliyapt
fvvqarhdeminpdsaniiyneiespvkqikwyeqsghvitldqekdqlhediyaflesl
dw

SCOPe Domain Coordinates for d1tqha_:

Click to download the PDB-style file with coordinates for d1tqha_.
(The format of our PDB-style files is described here.)

Timeline for d1tqha_: