Lineage for d1tqga_ (1tqg A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440553Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 440755Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (3 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 440781Family a.24.10.3: Chemotaxis protein CheA P1 domain [63512] (1 protein)
  6. 440782Protein Chemotaxis protein CheA P1 domain [63513] (2 species)
  7. 440788Species Thermotoga maritima [TaxId:243274] [109765] (1 PDB entry)
  8. 440789Domain d1tqga_: 1tqg A: [107224]

Details for d1tqga_

PDB Entry: 1tqg (more details), 0.98 Å

PDB Description: chea phosphotransferase domain from thermotoga maritima

SCOP Domain Sequences for d1tqga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqga_ a.24.10.3 (A:) Chemotaxis protein CheA P1 domain {Thermotoga maritima}
gshmeylgvfvdetkeylqnlndtlleleknpedmelineafralhtlkgmagtmgfssm
aklchtlenildkarnseikitsdlldkifagvdmitrmvdkivs

SCOP Domain Coordinates for d1tqga_:

Click to download the PDB-style file with coordinates for d1tqga_.
(The format of our PDB-style files is described here.)

Timeline for d1tqga_: