SCOPe 2.08: Domain d1tqga1: 1tqg A:4-104

Lineage for d1tqga1 (1tqg A:4-104)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.3: Chemotaxis protein CheA P1 domain [63512] (1 protein)

6. Protein Chemotaxis protein CheA P1 domain [63513] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [109765] (1 PDB entry)
   Uniprot Q56310 4-104

8. Domain d1tqga1: 1tqg A:4-104 [107224]
   Other proteins in same PDB: d1tqga2

Details for d1tqga1

PDB Entry: 1tqg, 0.98 Å

PDB Description: chea phosphotransferase domain from thermotoga maritima

PDB Compounds: (A:) chemotaxis protein chea

SCOPe Domain Sequences for d1tqga1:

Sequence; same for both SEQRES and ATOM records:

>d1tqga1 a.24.10.3 (A:4-104) Chemotaxis protein CheA P1 domain {Thermotoga maritima [TaxId: 2336]}
eylgvfvdetkeylqnlndtlleleknpedmelineafralhtlkgmagtmgfssmaklc
htlenildkarnseikitsdlldkifagvdmitrmvdkivs

Timeline for d1tqga1:

• d1tqga1 first appeared in SCOP 1.69, called d1tqga_
  
• d1tqga1 appears in SCOPe 2.07