Lineage for d1tqga1 (1tqg A:4-104)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987880Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 1987919Family a.24.10.3: Chemotaxis protein CheA P1 domain [63512] (1 protein)
  6. 1987920Protein Chemotaxis protein CheA P1 domain [63513] (2 species)
  7. 1987926Species Thermotoga maritima [TaxId:2336] [109765] (1 PDB entry)
    Uniprot Q56310 4-104
  8. 1987927Domain d1tqga1: 1tqg A:4-104 [107224]
    Other proteins in same PDB: d1tqga2

Details for d1tqga1

PDB Entry: 1tqg (more details), 0.98 Å

PDB Description: CheA phosphotransferase domain from Thermotoga maritima
PDB Compounds: (A:) chemotaxis protein chea

SCOPe Domain Sequences for d1tqga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqga1 a.24.10.3 (A:4-104) Chemotaxis protein CheA P1 domain {Thermotoga maritima [TaxId: 2336]}
eylgvfvdetkeylqnlndtlleleknpedmelineafralhtlkgmagtmgfssmaklc
htlenildkarnseikitsdlldkifagvdmitrmvdkivs

SCOPe Domain Coordinates for d1tqga1:

Click to download the PDB-style file with coordinates for d1tqga1.
(The format of our PDB-style files is described here.)

Timeline for d1tqga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tqga2