SCOP 1.71: Domain d1tqbc1: 1tqb C:1-107

Lineage for d1tqbc1 (1tqb C:1-107)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)

8. Domain d1tqbc1: 1tqb C:1-107 [107215]
   Other proteins in same PDB: d1tqba_, d1tqbb2, d1tqbc2
   MQ P01631 P01837 #
   natural chimera

Details for d1tqbc1

PDB Entry: 1tqb, 2.55 Å

PDB Description: Ovine recombinant PrP(114-234), VRQ variant in complex with the Fab of the VRQ14 antibody

SCOP Domain Sequences for d1tqbc1:

Sequence; same for both SEQRES and ATOM records:

>d1tqbc1 b.1.1.1 (C:1-107) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
dvvmsqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvsrld
sgvpdrftgsgsgtdftlkisrveaedlgiyfcwqgshfpqtfgggtkleik

Timeline for d1tqbc1:

• d1tqbc1 first appeared in SCOP 1.69
  
• d1tqbc1 appears in SCOP 1.73
  
• d1tqbc1 appears in the current release, SCOPe 2.08