Lineage for d1tq9a_ (1tq9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928455Protein Seminal ribonucleasease [54086] (1 species)
  7. 2928456Species Cow (Bos taurus) [TaxId:9913] [54087] (17 PDB entries)
    Uniprot P00669 27-150
  8. 2928463Domain d1tq9a_: 1tq9 A: [107210]
    complexed with cpa

Details for d1tq9a_

PDB Entry: 1tq9 (more details), 2 Å

PDB Description: non-covalent swapped dimer of bovine seminal ribonuclease in complex with 2'-deoxycytidine-2'-deoxyadenosine-3',5'-monophosphate
PDB Compounds: (A:) Ribonuclease, seminal

SCOPe Domain Sequences for d1tq9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tq9a_ d.5.1.1 (A:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

SCOPe Domain Coordinates for d1tq9a_:

Click to download the PDB-style file with coordinates for d1tq9a_.
(The format of our PDB-style files is described here.)

Timeline for d1tq9a_: