SCOPe 2.06: Domain d1tq8f1: 1tq8 F:15-159

Lineage for d1tq8f1 (1tq8 F:15-159)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)

share similar mode of ligand (Adenosine group) binding
can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
Pfam PF00582
Protein Hypothetical protein Rv1636 [110494] (1 species)
Species Mycobacterium tuberculosis [TaxId:1773] [110495] (1 PDB entry)
Uniprot O06153
Domain d1tq8f1: 1tq8 F:15-159 [107209]
Other proteins in same PDB: d1tq8a2, d1tq8b2, d1tq8c2, d1tq8d2, d1tq8e2, d1tq8f2
Structural genomics target

Details for d1tq8f1

PDB Entry: 1tq8 (more details), 2.4 Å

PDB Description: crystal structure of protein rv1636 from mycobacterium tuberculosis h37rv

PDB Compounds: (F:) hypothetical protein Rv1636

SCOPe Domain Sequences for d1tq8f1:

Sequence, based on SEQRES records: (download)

>d1tq8f1 c.26.2.4 (F:15-159) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]}
sayktvvvgtdgsdssmravdraaqiagadakliiasaylpqhedaraadilkdesykvt
gtapiyeilhdakerahnagaknveerpivgapvdalvnladeekadllvvgnvglstia
grllgsvpanvsrrakvdvlivhtt

Sequence, based on observed residues (ATOM records): (download)

>d1tq8f1 c.26.2.4 (F:15-159) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]}
sayktvvvgtdgsdssmravdraaqiagadakliiasaylptapiyeilhdakerahnag
aknveerpivgapvdalvnladeekadllvvgnvglstiagrllgsvpanvsrrakvdvl
ivhtt

SCOPe Domain Coordinates for d1tq8f1:

Click to download the PDB-style file with coordinates for d1tq8f1.
(The format of our PDB-style files is described here.)

Timeline for d1tq8f1: