Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.4: Universal stress protein-like [52436] (8 proteins) Pfam PF00582 |
Protein Hypothetical protein Rv1636 [110494] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [110495] (1 PDB entry) Uniprot O06153 |
Domain d1tq8d_: 1tq8 D: [107207] Structural genomics target |
PDB Entry: 1tq8 (more details), 2.4 Å
SCOPe Domain Sequences for d1tq8d_:
Sequence, based on SEQRES records: (download)
>d1tq8d_ c.26.2.4 (D:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} slsayktvvvgtdgsdssmravdraaqiagadakliiasaylpqhedaraadilkdesyk vtgtapiyeilhdakerahnagaknveerpivgapvdalvnladeekadllvvgnvglst iagrllgsvpanvsrrakvdvlivhtt
>d1tq8d_ c.26.2.4 (D:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} slsayktvvvgtdgsdssmravdraaqiagadakliiasaylptapiyeilhdakerahn agaknveerpivgapvdalvnladeekadllvvgnvglstiagrllgsvpanvsrrakvd vlivhtt
Timeline for d1tq8d_: