Lineage for d1tq8c_ (1tq8 C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482378Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 482696Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 482830Family c.26.2.4: Universal stress protein-like [52436] (4 proteins)
  6. 482839Protein Hypothetical protein Rv1636 [110494] (1 species)
  7. 482840Species Mycobacterium tuberculosis [TaxId:1773] [110495] (1 PDB entry)
  8. 482843Domain d1tq8c_: 1tq8 C: [107206]

Details for d1tq8c_

PDB Entry: 1tq8 (more details), 2.4 Å

PDB Description: crystal structure of protein rv1636 from mycobacterium tuberculosis h37rv

SCOP Domain Sequences for d1tq8c_:

Sequence, based on SEQRES records: (download)

>d1tq8c_ c.26.2.4 (C:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis}
slsayktvvvgtdgsdssmravdraaqiagadakliiasaylpqhedaraadilkdesyk
vtgtapiyeilhdakerahnagaknveerpivgapvdalvnladeekadllvvgnvglst
iagrllgsvpanvsrrakvdvlivhtt

Sequence, based on observed residues (ATOM records): (download)

>d1tq8c_ c.26.2.4 (C:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis}
slsayktvvvgtdgsdssmravdraaqiagadakliiasaylptapiyeilhdakerahn
agaknveerpivgapvdalvnladeekadllvvgnvglstiagrllgsvpanvsrrakvd
vlivhtt

SCOP Domain Coordinates for d1tq8c_:

Click to download the PDB-style file with coordinates for d1tq8c_.
(The format of our PDB-style files is described here.)

Timeline for d1tq8c_: