![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.4: Universal stress protein-like [52436] (4 proteins) |
![]() | Protein Hypothetical protein Rv1636 [110494] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [110495] (1 PDB entry) |
![]() | Domain d1tq8c_: 1tq8 C: [107206] |
PDB Entry: 1tq8 (more details), 2.4 Å
SCOP Domain Sequences for d1tq8c_:
Sequence, based on SEQRES records: (download)
>d1tq8c_ c.26.2.4 (C:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis} slsayktvvvgtdgsdssmravdraaqiagadakliiasaylpqhedaraadilkdesyk vtgtapiyeilhdakerahnagaknveerpivgapvdalvnladeekadllvvgnvglst iagrllgsvpanvsrrakvdvlivhtt
>d1tq8c_ c.26.2.4 (C:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis} slsayktvvvgtdgsdssmravdraaqiagadakliiasaylptapiyeilhdakerahn agaknveerpivgapvdalvnladeekadllvvgnvglstiagrllgsvpanvsrrakvd vlivhtt
Timeline for d1tq8c_: