Lineage for d1tq8c1 (1tq8 C:15-159)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
    Pfam PF00582
  6. Protein Hypothetical protein Rv1636 [110494] (1 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [110495] (1 PDB entry)
    Uniprot O06153
  8. Domain d1tq8c1: 1tq8 C:15-159 [107206]
    Other proteins in same PDB: d1tq8a2, d1tq8b2, d1tq8c2, d1tq8d2, d1tq8e2, d1tq8f2
    Structural genomics target

Details for d1tq8c1

PDB Entry: 1tq8 (more details), 2.4 Å

PDB Description: crystal structure of protein rv1636 from mycobacterium tuberculosis h37rv
PDB Compounds: (C:) hypothetical protein Rv1636

SCOPe Domain Sequences for d1tq8c1:

Sequence, based on SEQRES records: (download)

>d1tq8c1 c.26.2.4 (C:15-159) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]}
sayktvvvgtdgsdssmravdraaqiagadakliiasaylpqhedaraadilkdesykvt
gtapiyeilhdakerahnagaknveerpivgapvdalvnladeekadllvvgnvglstia
grllgsvpanvsrrakvdvlivhtt

Sequence, based on observed residues (ATOM records): (download)

>d1tq8c1 c.26.2.4 (C:15-159) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]}
sayktvvvgtdgsdssmravdraaqiagadakliiasaylptapiyeilhdakerahnag
aknveerpivgapvdalvnladeekadllvvgnvglstiagrllgsvpanvsrrakvdvl
ivhtt

SCOPe Domain Coordinates for d1tq8c1 are not available.

Timeline for d1tq8c1:

Domains from same chain:
(mouse over for more information)
d1tq8c2
Domains from other chains:
(mouse over for more information)
d1tq8a1, d1tq8a2, d1tq8b1, d1tq8b2, d1tq8d1, d1tq8d2, d1tq8e1, d1tq8e2, d1tq8f1, d1tq8f2