SCOP 1.69: Domain d1tq8a_: 1tq8 A:

Lineage for d1tq8a_ (1tq8 A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.4: Universal stress protein-like [52436] (4 proteins)

6. Protein Hypothetical protein Rv1636 [110494] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [110495] (1 PDB entry)

8. Domain d1tq8a_: 1tq8 A: [107204]

Details for d1tq8a_

PDB Entry: 1tq8, 2.4 Å

PDB Description: crystal structure of protein rv1636 from mycobacterium tuberculosis h37rv

SCOP Domain Sequences for d1tq8a_:

Sequence, based on SEQRES records:

>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis}
slsayktvvvgtdgsdssmravdraaqiagadakliiasaylpqhedaraadilkdesyk
vtgtapiyeilhdakerahnagaknveerpivgapvdalvnladeekadllvvgnvglst
iagrllgsvpanvsrrakvdvlivhtt

Sequence, based on observed residues (ATOM records):

>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis}
slsayktvvvgtdgsdssmravdraaqiagadakliiasaylptapiyeilhdakerahn
agaknveerpivgapvdalvnladeekadllvvgnvglstiagrllgsvpanvsrrakvd
vlivhtt

Timeline for d1tq8a_:

• d1tq8a_ is new in SCOP 1.69
  
• d1tq8a_ appears in SCOP 1.71
  
• d1tq8a_ appears in the current release, SCOPe 2.08, called d1tq8a1