Lineage for d1tq7.1 (1tq7 A:,B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 465597Protein Thrombin [50531] (2 species)
  7. 465644Species Human (Homo sapiens) [TaxId:9606] [50532] (155 PDB entries)
  8. 465766Domain d1tq7.1: 1tq7 A:,B: [107203]

Details for d1tq7.1

PDB Entry: 1tq7 (more details), 2.4 Å

PDB Description: crystal structure of the anticoagulant thrombin mutant w215a/e217a bound to ppack

SCOP Domain Sequences for d1tq7.1:

Sequence, based on SEQRES records: (download)

>g1tq7.1 b.47.1.2 (A:,B:) Thrombin {Human (Homo sapiens)}
yqtffnprtfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwq
vmlfrkspqellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerni
ekismlekiyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagyk
grvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdeg
krgdacegdsggpfvmkspfnnrwyqmgivsagagcdrdgkygfythvfrlkkwiqkvid
qf

Sequence, based on observed residues (ATOM records): (download)

>g1tq7.1 b.47.1.2 (A:,B:) Thrombin {Human (Homo sapiens)}
yqtffnprtfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwq
vmlfrkspqellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerni
ekismlekiyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagyk
grvtgwgnlketkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdac
egdsggpfvmkspfnnrwyqmgivsagagcdrdgkygfythvfrlkkwiqkvidqf

SCOP Domain Coordinates for d1tq7.1:

Click to download the PDB-style file with coordinates for d1tq7.1.
(The format of our PDB-style files is described here.)

Timeline for d1tq7.1: