Lineage for d1tq4a_ (1tq4 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484126Family c.37.1.8: G proteins [52592] (43 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 484352Protein Interferon-inducible GTPase [110546] (1 species)
  7. 484353Species Mouse (Mus musculus) [TaxId:10090] [110547] (5 PDB entries)
  8. 484354Domain d1tq4a_: 1tq4 A: [107201]
    G domain is inserted in all-alpha domain (14-68,252-415)

Details for d1tq4a_

PDB Entry: 1tq4 (more details), 1.95 Å

PDB Description: Crystal Structure of IIGP1: a paradigm for interferon inducible p47 resistance GTPases

SCOP Domain Sequences for d1tq4a_:

Sequence, based on SEQRES records: (download)

>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus)}
ndlpssftgyfkkfntgrkiisqeilnlielrmragniqltnsaisdalkeidssvlnva
vtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnipnvvfwdlpgigst
nfppdtylekmkfyeydffiiisatrfkkndidiakaismmkkefyfvrtkvdsditnea
dgepqtfdkekvlqdirlncvntfrengiaeppifllsnknvchydfpvlmdklisdlpi
ykrhnfmvslpnitdsviekkrqflkqriwlegfaadlvniipsltflldsdletlkksm
kfyrtvfgvdetslqrlardweievdqveamikspavfkptdeetiqerlsryiqefcla
ngyllpknsflkeifylkyyfldmvtedaktllkeiclrn

Sequence, based on observed residues (ATOM records): (download)

>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus)}
ndlpssftgyfkkfntgrkiisqeilnlielrmragniqltnsaisdalkeidssvlnva
vtgetgsgkssfintlrgigneeegaaktgvmerhpykhpnipnvvfwdlpgigstnfpp
dtylekmkfyeydffiiisatrfkkndidiakaismmkkefyfvrtkvdsditneadgep
qtfdkekvlqdirlncvntfrengiaeppifllsnknvchydfpvlmdklisdlpiykrh
nfmvslpnitdsviekkrqflkqriwlegfaadlvniipsltflldsdletlkksmkfyr
tvfgvdetslqrlardweievdqveamikspavfkptdeetiqerlsryiqefclangyl
lpknsflkeifylkyyfldmvtedaktllkeiclrn

SCOP Domain Coordinates for d1tq4a_:

Click to download the PDB-style file with coordinates for d1tq4a_.
(The format of our PDB-style files is described here.)

Timeline for d1tq4a_: