Lineage for d1tq2b_ (1tq2 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582105Protein Interferon-inducible GTPase [110546] (1 species)
    G domain is inserted in all-alpha domain
  7. 582106Species Mouse (Mus musculus) [TaxId:10090] [110547] (5 PDB entries)
  8. 582114Domain d1tq2b_: 1tq2 B: [107200]
    complexed with gnp, mg, mpd

Details for d1tq2b_

PDB Entry: 1tq2 (more details), 2.7 Å

PDB Description: Crystal Structure of IIGP1: a paradigm for interferon inducible p47 resistance GTPases

SCOP Domain Sequences for d1tq2b_:

Sequence, based on SEQRES records: (download)

>d1tq2b_ c.37.1.8 (B:) Interferon-inducible GTPase {Mouse (Mus musculus)}
ndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisdalkeidssvlnva
vtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnipnvvfwdlpgigst
nfppdtylekmkfyeydffiiisatrfkkndidiakaismmkkefyfvrtkvdsditnea
dgkpqtfdkekvlqdirlncvntfrengiaeppifllsnknvchydfpvlmdklisdlpi
ykrhnfmvslpnitdsviekkrqflkqriwlegfaadlvniipsltflldsdletlkksm
kfyrtvfgvdetslqrlardweievdqveamikspavfkptdeetiqerlsryiqefcla
ngyllpknsflkeifylkyyfldmvtedaktllkeiclklgr

Sequence, based on observed residues (ATOM records): (download)

>d1tq2b_ c.37.1.8 (B:) Interferon-inducible GTPase {Mouse (Mus musculus)}
ndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisdalkeidssvlnva
vtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnipnvvfwdlpgigst
nfppdtylekmkfyeydffiiisatrfkkndidiakaismmkkefyfvrtkvdsditnee
kvlqdirlncvntfrengiaeppifllsnknvchydfpvlmdklisdlpiykrhnfmvsl
pnitdsviekkrqflkqriwlegfaadlvniipsltflldsdletlkksmkfyrtvfgvd
etslqrlardweievdqveamikspavfkptdeetiqerlsryiqefclangyllpknsf
lkeifylkyyfldmvtedaktllkeiclklgr

SCOP Domain Coordinates for d1tq2b_:

Click to download the PDB-style file with coordinates for d1tq2b_.
(The format of our PDB-style files is described here.)

Timeline for d1tq2b_: