Lineage for d1tq2b1 (1tq2 B:14-411)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110575Protein Interferon-inducible GTPase [110546] (1 species)
    G domain is inserted in all-alpha domain
  7. 2110576Species Mouse (Mus musculus) [TaxId:10090] [110547] (5 PDB entries)
    Uniprot Q9QZ85 # all-alpha domain (14-68,252-415)
  8. 2110584Domain d1tq2b1: 1tq2 B:14-411 [107200]
    Other proteins in same PDB: d1tq2a2, d1tq2b2
    complexed with gnp, mg, mpd

Details for d1tq2b1

PDB Entry: 1tq2 (more details), 2.7 Å

PDB Description: Crystal Structure of IIGP1: a paradigm for interferon inducible p47 resistance GTPases
PDB Compounds: (B:) interferon-inducible GTPase

SCOPe Domain Sequences for d1tq2b1:

Sequence, based on SEQRES records: (download)

>d1tq2b1 c.37.1.8 (B:14-411) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]}
ndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisdalkeidssvlnva
vtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnipnvvfwdlpgigst
nfppdtylekmkfyeydffiiisatrfkkndidiakaismmkkefyfvrtkvdsditnea
dgkpqtfdkekvlqdirlncvntfrengiaeppifllsnknvchydfpvlmdklisdlpi
ykrhnfmvslpnitdsviekkrqflkqriwlegfaadlvniipsltflldsdletlkksm
kfyrtvfgvdetslqrlardweievdqveamikspavfkptdeetiqerlsryiqefcla
ngyllpknsflkeifylkyyfldmvtedaktllkeicl

Sequence, based on observed residues (ATOM records): (download)

>d1tq2b1 c.37.1.8 (B:14-411) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]}
ndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisdalkeidssvlnva
vtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnipnvvfwdlpgigst
nfppdtylekmkfyeydffiiisatrfkkndidiakaismmkkefyfvrtkvdsditnee
kvlqdirlncvntfrengiaeppifllsnknvchydfpvlmdklisdlpiykrhnfmvsl
pnitdsviekkrqflkqriwlegfaadlvniipsltflldsdletlkksmkfyrtvfgvd
etslqrlardweievdqveamikspavfkptdeetiqerlsryiqefclangyllpknsf
lkeifylkyyfldmvtedaktllkeicl

SCOPe Domain Coordinates for d1tq2b1:

Click to download the PDB-style file with coordinates for d1tq2b1.
(The format of our PDB-style files is described here.)

Timeline for d1tq2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tq2b2