SCOPe 2.06: Domain d1tq1a_: 1tq1 A:

Lineage for d1tq1a_ (1tq1 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.3: Single-domain sulfurtransferase [69509] (3 proteins)

6. Protein Thiosulfate sulfurtransferase/Senescence-associated protein [110600] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110601] (1 PDB entry)
   Uniprot Q39129

8. Domain d1tq1a_: 1tq1 A: [107198]
   Structural genomics target

Details for d1tq1a_

PDB Entry: 1tq1

PDB Description: solution structure of at5g66040, a putative protein from arabidosis thaliana

PDB Compounds: (A:) senescence-associated family protein

SCOPe Domain Sequences for d1tq1a_:

Sequence; same for both SEQRES and ATOM records:

>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
aeesrvpssvsvtvahdlllaghryldvrtpeefsqghacgainvpymnrgasgmskntd
fleqvsshfgqsdniivgcqsggrsikattdllhagftgvkdivggysawaknglptka

Timeline for d1tq1a_:

• d1tq1a_ first appeared in SCOP 1.69
  
• d1tq1a_ appears in SCOPe 2.05
  
• d1tq1a_ appears in SCOPe 2.07
  
• d1tq1a_ appears in the current release, SCOPe 2.08