Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families) Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
Family c.46.1.3: Single-domain sulfurtransferase [69509] (3 proteins) |
Protein Thiosulfate sulfurtransferase/Senescence-associated protein [110600] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110601] (1 PDB entry) |
Domain d1tq1a_: 1tq1 A: [107198] Structural genomics target |
PDB Entry: 1tq1 (more details)
SCOP Domain Sequences for d1tq1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} aeesrvpssvsvtvahdlllaghryldvrtpeefsqghacgainvpymnrgasgmskntd fleqvsshfgqsdniivgcqsggrsikattdllhagftgvkdivggysawaknglptka
Timeline for d1tq1a_: