Lineage for d1tq1a_ (1tq1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876007Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2876008Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 2876086Family c.46.1.3: Single-domain sulfurtransferase [69509] (3 proteins)
  6. 2876095Protein Thiosulfate sulfurtransferase/Senescence-associated protein [110600] (1 species)
  7. 2876096Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110601] (1 PDB entry)
    Uniprot Q39129
  8. 2876097Domain d1tq1a_: 1tq1 A: [107198]
    Structural genomics target

Details for d1tq1a_

PDB Entry: 1tq1 (more details)

PDB Description: solution structure of at5g66040, a putative protein from arabidosis thaliana
PDB Compounds: (A:) senescence-associated family protein

SCOPe Domain Sequences for d1tq1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
aeesrvpssvsvtvahdlllaghryldvrtpeefsqghacgainvpymnrgasgmskntd
fleqvsshfgqsdniivgcqsggrsikattdllhagftgvkdivggysawaknglptka

SCOPe Domain Coordinates for d1tq1a_:

Click to download the PDB-style file with coordinates for d1tq1a_.
(The format of our PDB-style files is described here.)

Timeline for d1tq1a_: