Lineage for d1tpxa_ (1tpx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928689Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2928690Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2928691Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2928692Protein Prion protein domain [54100] (14 species)
  7. 2928743Species Sheep (Ovis aries) [TaxId:9940] [102729] (6 PDB entries)
    Uniprot P23907 124-234 ! Uniprot P23907 122-234 ! Uniprot P23907 127-228
  8. 2928748Domain d1tpxa_: 1tpx A: [107189]
    Other proteins in same PDB: d1tpxb1, d1tpxb2, d1tpxc1, d1tpxc2

Details for d1tpxa_

PDB Entry: 1tpx (more details), 2.56 Å

PDB Description: Ovine recombinant PrP(114-234), ARQ variant in complex with the Fab of the VRQ14 antibody
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d1tpxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpxa_ d.6.1.1 (A:) Prion protein domain {Sheep (Ovis aries) [TaxId: 9940]}
glggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnit
vkqhtvttttkgenftetdikimervveqmcitqyqresqay

SCOPe Domain Coordinates for d1tpxa_:

Click to download the PDB-style file with coordinates for d1tpxa_.
(The format of our PDB-style files is described here.)

Timeline for d1tpxa_: