SCOPe 2.06: Domain d1tp8.4: 1tp8 H:,G:

Lineage for d1tp8.4 (1tp8 H:,G:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)

6. Protein Jacalin [51103] (2 species)

7. Species Artocarpus hirsuta [TaxId:291940] [110308] (2 PDB entries)
   Uniprot Q38723 64-217 95% sequence identity

8. Domain d1tp8.4: 1tp8 H:,G: [107188]
   complexed with amg

Details for d1tp8.4

PDB Entry: 1tp8, 3 Å

PDB Description: crystal structure of a galactose specific lectin from artocarpus hirsuta in complex with methyl-a-d-galactose

PDB Compounds: (G:) agglutinin alpha chain, (H:) agglutinin beta chain

SCOPe Domain Sequences for d1tp8.4:

Sequence; same for both SEQRES and ATOM records:

>g1tp8.4 b.77.3.1 (H:,G:) Jacalin {Artocarpus hirsuta [TaxId: 291940]}
sgksqtvivgpwgakvXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqn
hssfisgftpvkisldfpseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtp
fnlpienglivgfkgsigywmdyfsmylsl

Timeline for d1tp8.4:

• d1tp8.4 first appeared in SCOP 1.69
  
• d1tp8.4 appears in SCOPe 2.05
  
• d1tp8.4 appears in SCOPe 2.07
  
• d1tp8.4 appears in the current release, SCOPe 2.08